| Product Number |
ARP94180_P050 |
| Product Page |
www.avivasysbio.com/mcu-antibody-c-terminal-region-arp94180-p050.html |
| Name |
MCU Antibody - C-terminal region (ARP94180_P050) |
| Protein Size (# AA) |
201 amino acids |
| Molecular Weight |
24 kDa |
| NCBI Gene Id |
215999 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
mitochondrial calcium uniporter |
| Alias Symbols |
Gm64, Ccdc109, AV064928, C10orf42, Ccdc109a, 2010012O16Rik, D130073L02Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: YPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MCU (ARP94180_P050) antibody |
| Blocking Peptide |
For anti-MCU (ARP94180_P050) antibody is Catalog # AAP94180 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse CCDC109A |
| Uniprot ID |
Q3UMR5-2 |
| Protein Name |
calcium uniporter protein, mitochondrial |
| Protein Accession # |
NP_001028431.2 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001033259.4 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
MCU |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Image 1 | Mouse Pancreas
 | Host: Rabbit
Target Name: CCDC109A
Sample Tissue: Mouse Pancreas lysates
Antibody Dilution: 1ug/ml |
|
|
