| Product Number |
ARP91925_P050 |
| Product Page |
www.avivasysbio.com/alox12b-antibody-c-terminal-region-arp91925-p050.html |
| Name |
ALOX12B Antibody - C-terminal region (ARP91925_P050) |
| Protein Size (# AA) |
701 amino acids |
| Molecular Weight |
81 kDa |
| NCBI Gene Id |
11686 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
arachidonate 12-lipoxygenase, 12R type |
| Alias Symbols |
Alo, 12R-, e-LO, Aloxe2, e-LOX2, 12R-LOX |
| Peptide Sequence |
Synthetic peptide located within the following region: GLTTLQTYMDTLPDVKTTCIVLLVLWTLCREPDDRRPLGHFPDIHFVEEG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes an enzyme involved in the conversion of arachidonic acid to 12R-hydroxyeicosatetraenoic acid. Mutations in this gene can prevent the formation of the epidermal permeability barrier and cause an ichthyosiform phenotype. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ALOX12B (ARP91925_P050) antibody |
| Blocking Peptide |
For anti-ALOX12B (ARP91925_P050) antibody is Catalog # ARP91925_P050 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse ALOX12B |
| Uniprot ID |
O70582 |
| Protein Name |
Arachidonate 12-lipoxygenase, 12R-type |
| Protein Accession # |
NP_033789.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_009659.2 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
ALOX12B |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Image 1 | Mouse Testis
 | Host: Rabbit
Target Name: ALOX12B
Sample Tissue: Mouse Testis lysates
Antibody Dilution: 1ug/ml |
|
|
