Product Number |
ARP90618_P050 |
Product Page |
www.avivasysbio.com/mtf1-antibody-middle-region-arp90618-p050.html |
Name |
MTF1 Antibody - middle region (ARP90618_P050) |
Protein Size (# AA) |
675 amino acids |
Molecular Weight |
74 kDa |
NCBI Gene Id |
17764 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
metal response element binding transcription factor 1 |
Alias Symbols |
Thy, MTF-1, Thyls |
Peptide Sequence |
Synthetic peptide located within the following region: THTGERPFFCPSNGCEKTFSTQYSLKSHMKGHDNKGTAYSALPQHNGSED |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Activates the metallothionein I promoter. Binds to the metal responsive element (MRE). |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MTF1 (ARP90618_P050) antibody |
Blocking Peptide |
For anti-MTF1 (ARP90618_P050) antibody is Catalog # AAP90618 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse MTF1 |
Uniprot ID |
Q07243 |
Protein Name |
metal regulatory transcription factor 1 |
Protein Accession # |
NP_032662.3 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_008636.4 |
Gene Symbol |
MTF1 |
Predicted Species Reactivity |
Mouse |
Application |
WB |
Image 1 | Mouse Skeletal Muscle
| Host: Rabbit Target Name: MTF1 Sample Tissue: Mouse Skeletal Muscle lysates Antibody Dilution: 1ug/ml |
|
|