MTF1 Antibody - middle region (ARP90618_P050)

Data Sheet
 
Product Number ARP90618_P050
Product Page www.avivasysbio.com/mtf1-antibody-middle-region-arp90618-p050.html
Name MTF1 Antibody - middle region (ARP90618_P050)
Protein Size (# AA) 675 amino acids
Molecular Weight 74 kDa
NCBI Gene Id 17764
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name metal response element binding transcription factor 1
Alias Symbols Thy, MTF-1, Thyls
Peptide Sequence Synthetic peptide located within the following region: THTGERPFFCPSNGCEKTFSTQYSLKSHMKGHDNKGTAYSALPQHNGSED
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Activates the metallothionein I promoter. Binds to the metal responsive element (MRE).
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MTF1 (ARP90618_P050) antibody
Blocking Peptide For anti-MTF1 (ARP90618_P050) antibody is Catalog # AAP90618
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse MTF1
Uniprot ID Q07243
Protein Name metal regulatory transcription factor 1
Protein Accession # NP_032662.3
Purification Affinity purified
Nucleotide Accession # NM_008636.4
Gene Symbol MTF1
Predicted Species Reactivity Mouse
Application WB
Image 1
Mouse Skeletal Muscle
Host: Rabbit
Target Name: MTF1
Sample Tissue: Mouse Skeletal Muscle lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com