CD247 Antibody - middlel region (ARP90385_P050)

Data Sheet
 
Product Number ARP90385_P050
Product Page www.avivasysbio.com/cd247-antibody-middlel-region-arp90385-p050.html
Name CD247 Antibody - middlel region (ARP90385_P050)
Protein Size (# AA) 164 amino acids
Molecular Weight 18 kDa
NCBI Gene Id 12503
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name CD247 antigen
Alias Symbols Cd3, T3z, TCR, Cd3h, Cd3z, Tcrk, Tcrz, CD3-et, CD3zet, CD3-zet, Cd3-eta, Cd3zeta, AW552088, Cd3-zeta, A430104F18, 4930549J05Rik, A430104F18Rik
Peptide Sequence Synthetic peptide located within the following region: NPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Plays an important role in intrathymic T-cell differentiation. Additionally, participates in the activity-dependent synapse formation of retinal ganglion cells (RGCs) in both the retina and dorsal lateral geniculate nucleus (dLGN).
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CD247 (ARP90385_P050) antibody
Blocking Peptide For anti-CD247 (ARP90385_P050) antibody is Catalog # AAP90385
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse CD247
Uniprot ID P24161
Protein Name CD247 antigen
Protein Accession # NP_001106862.1
Purification Affinity purified
Nucleotide Accession # NM_001113391.2
Gene Symbol CD247
Predicted Species Reactivity Mouse
Application WB
Image 1
Mouse Lung
Host: Rabbit
Target Name: CD247
Sample Tissue: Mouse Lung lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com