Product Number |
ARP90385_P050 |
Product Page |
www.avivasysbio.com/cd247-antibody-middlel-region-arp90385-p050.html |
Name |
CD247 Antibody - middlel region (ARP90385_P050) |
Protein Size (# AA) |
164 amino acids |
Molecular Weight |
18 kDa |
NCBI Gene Id |
12503 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
CD247 antigen |
Alias Symbols |
Cd3, T3z, TCR, Cd3h, Cd3z, Tcrk, Tcrz, CD3-et, CD3zet, CD3-zet, Cd3-eta, Cd3zeta, AW552088, Cd3-zeta, A430104F18, 4930549J05Rik, A430104F18Rik |
Peptide Sequence |
Synthetic peptide located within the following region: NPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Plays an important role in intrathymic T-cell differentiation. Additionally, participates in the activity-dependent synapse formation of retinal ganglion cells (RGCs) in both the retina and dorsal lateral geniculate nucleus (dLGN). |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CD247 (ARP90385_P050) antibody |
Blocking Peptide |
For anti-CD247 (ARP90385_P050) antibody is Catalog # AAP90385 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse CD247 |
Uniprot ID |
P24161 |
Protein Name |
CD247 antigen |
Protein Accession # |
NP_001106862.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001113391.2 |
Gene Symbol |
CD247 |
Predicted Species Reactivity |
Mouse |
Application |
WB |
Image 1 | Mouse Lung
| Host: Rabbit Target Name: CD247 Sample Tissue: Mouse Lung lysates Antibody Dilution: 1ug/ml |
|
|