STX1A Antibody - N-terminal region (ARP90001_P050)

Data Sheet
 
Product Number ARP90001_P050
Product Page www.avivasysbio.com/stx1a-antibody-n-terminal-region-arp90001-p050.html
Product Name STX1A Antibody - N-terminal region (ARP90001_P050)
Size 100 ul
Gene Symbol STX1A
Alias Symbols HPC-1
Protein Size (# AA) 288 amino acids
Molecular Weight 33 kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 20907
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name syntaxin 1A (brain)
Peptide Sequence Synthetic peptide located within the following region: KDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENV
Description of Target Plays a role in hormone and neurotransmitter exocytosis (By similarity). Potentially involved in docking of synaptic vesicles at presynaptic active zones. May mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm (PubMed:15774481).
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-STX1A (ARP90001_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 24 hours delivery International: 3-5 business days
Blocking Peptide For anti-STX1A (ARP90001_P050) antibody is Catalog # AAP90001
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse STX1A
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express STX1A.
Swissprot Id O35526
Protein Name syntaxin-1A
Protein Accession # NP_058081.2
Purification Affinity purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express STX1A.
Nucleotide Accession # NM_016801.4
Tested Species Reactivity Mouse
Predicted Species Reactivity Mouse
Application WB
Image 1
Mouse Lung
Host: Rabbit
Target Name: STX1A
Sample Tissue: Mouse Lung lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com