Product Number |
ARP89547_P050 |
Product Page |
www.avivasysbio.com/shb-antibody-middle-region-arp89547-p050.html |
Name |
SHB Antibody - middle region (ARP89547_P050) |
Protein Size (# AA) |
217 amino acids |
Molecular Weight |
23 kDa |
NCBI Gene Id |
230126 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
src homology 2 domain-containing transforming protein B |
Alias Symbols |
BC028832 |
Peptide Sequence |
Synthetic peptide located within the following region: LPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. May play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. May also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. May also regulate IRS1 and IRS2 signaling in insulin-producing cells (By similarity). |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SHB (ARP89547_P050) antibody |
Blocking Peptide |
For anti-SHB (ARP89547_P050) antibody is Catalog # AAP89547 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse SHB |
Uniprot ID |
Q6PD21-2 |
Protein Name |
SH2 domain-containing adapter protein B |
Protein Accession # |
NP_001028478.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001033306.1 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
SHB |
Predicted Species Reactivity |
Mouse |
Application |
WB |
Image 1 | Mouse Testis
| Host: Rabbit Target Name: SHB Sample Tissue: Mouse Testis lysates Antibody Dilution: 1ug/ml |
|
|