SHB Antibody - middle region (ARP89547_P050)

Data Sheet
 
Product Number ARP89547_P050
Product Page www.avivasysbio.com/shb-antibody-middle-region-arp89547-p050.html
Name SHB Antibody - middle region (ARP89547_P050)
Protein Size (# AA) 217 amino acids
Molecular Weight 23 kDa
NCBI Gene Id 230126
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name src homology 2 domain-containing transforming protein B
Alias Symbols BC028832
Peptide Sequence Synthetic peptide located within the following region: LPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. May play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. May also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. May also regulate IRS1 and IRS2 signaling in insulin-producing cells (By similarity).
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SHB (ARP89547_P050) antibody
Blocking Peptide For anti-SHB (ARP89547_P050) antibody is Catalog # AAP89547
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse SHB
Uniprot ID Q6PD21-2
Protein Name SH2 domain-containing adapter protein B
Protein Accession # NP_001028478.1
Purification Affinity purified
Nucleotide Accession # NM_001033306.1
Tested Species Reactivity Mouse
Gene Symbol SHB
Predicted Species Reactivity Mouse
Application WB
Image 1
Mouse Testis
Host: Rabbit
Target Name: SHB
Sample Tissue: Mouse Testis lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com