| Product Number |
ARP89382_P050 |
| Product Page |
www.avivasysbio.com/mmp12-antibody-middle-region-arp89382-p050.html |
| Name |
MMP12 Antibody - middle region (ARP89382_P050) |
| Protein Size (# AA) |
473 amino acids |
| Molecular Weight |
52 kDa |
| NCBI Gene Id |
17381 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
matrix metallopeptidase 12 |
| Alias Symbols |
MME, MMP1, Mmel, AV378681 |
| Peptide Sequence |
Synthetic peptide located within the following region: STFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the matrix metalloproteinase family of extracellular matrix-degrading enzymes that are involved in tissue remodeling, wound repair, progression of atherosclerosis and tumor invasion. The encoded preproprotein undergoes proteolytic processing to generate a mature, zinc-dependent endopeptidase enzyme. Mice lacking the encoded protein have a diminished capacity to degrade extracellular matrix components, do not develop emphysema in response to long-term exposure to cigarette smoke, and exhibit impaired clearance and increased mortality upon bacterial infection. This gene is located in a cluster of other matrix metalloproteinase genes on chromosome 9. Alternate splicing generates multiple transcript variants encoding distinct isoforms. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MMP12 (ARP89382_P050) antibody |
| Blocking Peptide |
For anti-MMP12 (ARP89382_P050) antibody is Catalog # AAP89382 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse MMP12 |
| Uniprot ID |
P34960 |
| Protein Name |
macrophage metalloelastase |
| Protein Accession # |
NP_001307005.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001320076.1 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
MMP12 |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Image 1 | Mouse Brain
 | Host: Rabbit
Target Name: MMP12
Sample Tissue: Mouse Brain lysates
Antibody Dilution: 1ug/ml |
|
|
