| Product Number |
ARP89313_P050 |
| Product Page |
www.avivasysbio.com/kmo-antibody-middle-region-arp89313-p050.html |
| Name |
KMO Antibody - middle region (ARP89313_P050) |
| Protein Size (# AA) |
479 amino acids |
| Molecular Weight |
52 kDa |
| NCBI Gene Id |
98256 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) |
| Alias Symbols |
AI046660 |
| Peptide Sequence |
Synthetic peptide located within the following region: QGMNAGFEDCLVFDELMDKFNNNLSMCLPEFSRFRIPDDHAISDLSMYNY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). Required for synthesis of quinolinic acid, a neurotoxic NMDA receptor antagonist and potential endogenous inhibitor of NMDA receptor signaling in axonal targeting, synaptogenesis and apoptosis during brain development. Quinolinic acid may also affect NMDA receptor signaling in pancreatic beta cells, osteoblasts, myocardial cells, and the gastrointestinal tract. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KMO (ARP89313_P050) antibody |
| Blocking Peptide |
For anti-KMO (ARP89313_P050) antibody is Catalog # AAP89313 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse KMO |
| Uniprot ID |
Q91WN4 |
| Protein Name |
AI046660 |
| Protein Accession # |
NP_598570.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_133809.1 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
KMO |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Image 1 | Mouse Brain
 | Host: Rabbit
Target Name: KMO
Sample Tissue: Mouse Brain lysates
Antibody Dilution: 1ug/ml |
|
|
