TCF4 Antibody - middle region (ARP89031_P050)

• Product Number: ARP89031_P050
• Name: TCF4 Antibody - middle region (ARP89031_P050)
• Protein Size (# AA): 511 amino acids
• Molecular Weight: 56 kDa
• NCBI Gene Id: 21413
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: transcription factor 4
• Alias Symbols: AS, ME2, TFE, E2-2, E2.2, ITF-, ITF2, SEF-, SEF2, ITF-2, MITF-, SEF-2, SEF2-, Tcf-4, ASP-I2, ITF-2b, SEF2-1, bHLHb1, MITF-2A, MITF-2B, bHLHb19, 5730422P05Rik
• Peptide Sequence: Synthetic peptide located within the following region: QDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Transcription factor that binds to the immunoglobulin enhancer Mu-E5/KE5-motif. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Isoform 2 inhibits MYOD1 activation of the cardiac alpha-actin promoter. Binds to the E-box present in the somatostatin receptor 2 initiator element (SSTR2-INR) to activate transcription. May have a regulatory function in developmental processes as well as during neuronal plasticity.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TCF4 (ARP89031_P050) antibody is Catalog # AAP89031
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse TCF4
• Uniprot ID: Q60722-2
• Protein Name: transcription factor 4
• Protein Accession #: NP_001077436.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_001083967.1
• Tested Species Reactivity: Mouse
• Gene Symbol: TCF4
• Predicted Species Reactivity: Mouse
• Application: WB
• Image 1: Mouse Pancreas
  
  Host: Rabbit
  Target Name: TCF4
  Sample Tissue: Mouse Pancreas lysates
  Antibody Dilution: 1ug/ml