| Product Number |
ARP88924_P050 |
| Product Page |
www.avivasysbio.com/traf6-antibody-middle-region-arp88924-p050.html |
| Name |
TRAF6 Antibody - middle region (ARP88924_P050) |
| Protein Size (# AA) |
530 amino acids |
| Molecular Weight |
58 kDa |
| NCBI Gene Id |
22034 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
TNF receptor-associated factor 6 |
| Alias Symbols |
AI851288, 2310003F17Rik, C630032O20Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: MRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the TNF receptor associated factor (TRAF) family of adaptor proteins that mediate signaling events from members of the TNF receptor and Toll/IL-1 receptor families to activate transcription factors such as NF-kappa-B and AP-1. The product of this gene is essential for perinatal and postnatal survival. Mice deficient in this protein exhibit osteopetrosis and defective in development of epidermal appendixes, normal B cell differentiation, lymph node organogenesis, interleukin-1 signaling, lipopolysaccharide signaling and neural tube closure. This protein possesses ubiquitin ligase activity. Alternate splicing of this gene results in multiple transcript variants. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TRAF6 (ARP88924_P050) antibody |
| Blocking Peptide |
For anti-TRAF6 (ARP88924_P050) antibody is Catalog # AAP88924 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse TRAF6 |
| Uniprot ID |
P70196 |
| Protein Name |
TNF receptor-associated factor 6 |
| Protein Accession # |
NP_001290202.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001303273.1 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
TRAF6 |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Image 1 | Mouse Kidney
 | Host: Rabbit
Target Name: TRAF6
Sample Tissue: Mouse Kidney lysates
Antibody Dilution: 1ug/ml |
|
|
