| Product Number |
ARP88743_P050 |
| Product Page |
www.avivasysbio.com/mapk7-antibody-n-terminal-region-arp88743-p050.html |
| Name |
MAPK7 Antibody - N-terminal region (ARP88743_P050) |
| Protein Size (# AA) |
533 amino acids |
| Molecular Weight |
58 kDa |
| NCBI Gene Id |
5598 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
mitogen-activated protein kinase 7 |
| Alias Symbols |
BMK1, ERK4, ERK5, PRKM7 |
| Peptide Sequence |
Synthetic peptide located within the following region: MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is specifically activated by mitogen-activated protein kinase kinase 5 (MAP2K5/MEK5). It is involved in the downstream signaling processes of various receptor molecules including receptor type kinases, and G protein-coupled receptors. In response to extracelluar signals, this kinase translocates to cell nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors. Four alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MAPK7 (ARP88743_P050) antibody |
| Blocking Peptide |
For anti-MAPK7 (ARP88743_P050) antibody is Catalog # AAP88743 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MAPK7 |
| Uniprot ID |
Q13164-3 |
| Protein Name |
mitogen-activated protein kinase 7 |
| Protein Accession # |
NP_002740.2 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_002749.3 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MAPK7 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human U937 Whole Cell
 | Host: Rabbit
Target Name: MAPK7
Sample Tissue: Human U937 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
