MRVI1 Antibody - middle region (ARP88721_P050)

Data Sheet
 
Product Number ARP88721_P050
Product Page www.avivasysbio.com/mrvi1-antibody-middle-region-arp88721-p050.html
Name MRVI1 Antibody - middle region (ARP88721_P050)
Protein Size (# AA) 885 amino acids
Molecular Weight 97 kDa
NCBI Gene Id 10335
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name murine retrovirus integration site 1 homolog
Alias Symbols IRAG, JAW1L, MRVI1
Peptide Sequence Synthetic peptide located within the following region: LADRKQNDQRKVSQGRLAPRPPPVEKSKEIAIEQKENFDPLQYPETTPKG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene is similar to a putative mouse tumor suppressor gene (Mrvi1) that is frequently disrupted by mouse AIDS-related virus (MRV). The encoded protein, which is found in the membrane of the endoplasmic reticulum, is similar to Jaw1, a lymphoid-restricted protein whose expression is down-regulated during lymphoid differentiation. This protein is a substrate of cGMP-dependent kinase-1 (PKG1) that can function as a regulator of IP3-induced calcium release. Studies in mouse suggest that MRV integration at Mrvi1 induces myeloid leukemia by altering the expression of a gene important for myeloid cell growth and/or differentiation, and thus this gene may function as a myeloid leukemia tumor suppressor gene. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene, and alternative translation start sites, including a non-AUG (CUG) start site, are used.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MRVI1 (ARP88721_P050) antibody
Blocking Peptide For anti-MRVI1 (ARP88721_P050) antibody is Catalog # AAP88721
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MRVI1
Uniprot ID Q9Y6F6
Protein Name protein MRVI1
Protein Accession # NP_001092049.2
Purification Affinity purified
Nucleotide Accession # NM_001098579.2
Tested Species Reactivity Human
Gene Symbol MRVI1
Predicted Species Reactivity Human
Application WB
Image 1
Human Mesenchymoma Tumor
Host: Rabbit
Target Name: MRVI1
Sample Tissue: Human Mesenchymoma Tumor lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com