Product Number |
ARP88721_P050 |
Product Page |
www.avivasysbio.com/mrvi1-antibody-middle-region-arp88721-p050.html |
Name |
MRVI1 Antibody - middle region (ARP88721_P050) |
Protein Size (# AA) |
885 amino acids |
Molecular Weight |
97 kDa |
NCBI Gene Id |
10335 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
murine retrovirus integration site 1 homolog |
Alias Symbols |
IRAG, JAW1L, MRVI1 |
Peptide Sequence |
Synthetic peptide located within the following region: LADRKQNDQRKVSQGRLAPRPPPVEKSKEIAIEQKENFDPLQYPETTPKG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene is similar to a putative mouse tumor suppressor gene (Mrvi1) that is frequently disrupted by mouse AIDS-related virus (MRV). The encoded protein, which is found in the membrane of the endoplasmic reticulum, is similar to Jaw1, a lymphoid-restricted protein whose expression is down-regulated during lymphoid differentiation. This protein is a substrate of cGMP-dependent kinase-1 (PKG1) that can function as a regulator of IP3-induced calcium release. Studies in mouse suggest that MRV integration at Mrvi1 induces myeloid leukemia by altering the expression of a gene important for myeloid cell growth and/or differentiation, and thus this gene may function as a myeloid leukemia tumor suppressor gene. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene, and alternative translation start sites, including a non-AUG (CUG) start site, are used. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MRVI1 (ARP88721_P050) antibody |
Blocking Peptide |
For anti-MRVI1 (ARP88721_P050) antibody is Catalog # AAP88721 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MRVI1 |
Uniprot ID |
Q9Y6F6 |
Protein Name |
protein MRVI1 |
Protein Accession # |
NP_001092049.2 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001098579.2 |
Tested Species Reactivity |
Human |
Gene Symbol |
MRVI1 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human Mesenchymoma Tumor
| Host: Rabbit Target Name: MRVI1 Sample Tissue: Human Mesenchymoma Tumor lysates Antibody Dilution: 1ug/ml |
|
|