KCNIP3 Antibody - N-terminal region (ARP88612_P050)

Data Sheet
 
Product Number ARP88612_P050
Product Page www.avivasysbio.com/kcnip3-antibody-n-terminal-region-arp88612-p050.html
Product Name KCNIP3 Antibody - N-terminal region (ARP88612_P050)
Size 100 ul
Gene Symbol KCNIP3
Alias Symbols CSEN, DREAM, KCHIP3
Protein Size (# AA) 256 amino acids
Molecular Weight 29 kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 30818
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name potassium voltage-gated channel interacting protein 3
Peptide Sequence Synthetic peptide located within the following region: LLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGSDSSD
Description of Target This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domains. They are integral subunit components of native Kv4 channel complexes that may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The encoded protein also functions as a calcium-regulated transcriptional repressor, and interacts with presenilins. Alternatively spliced transcript variants encoding different isoforms have been described.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-KCNIP3 (ARP88612_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 24 hours delivery International: 3-5 business days
Blocking Peptide For anti-KCNIP3 (ARP88612_P050) antibody is Catalog # AAP88612
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP3
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KCNIP3.
Swissprot Id Q9Y2W7
Protein Name Calsenilin
Protein Accession # NP_001030086.1
Purification Affinity purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KCNIP3.
Nucleotide Accession # NM_001034914.1
Tested Species Reactivity Human
Predicted Species Reactivity Human
Application WB
Image 1
Human Mesenchymoma Tumor
Host: Rabbit
Target Name: KCNIP3
Sample Tissue: Human Mesenchymoma Tumor lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com