| Product Number |
ARP88448_P050 |
| Product Page |
www.avivasysbio.com/myoz1-antibody-middle-region-arp88448-p050.html |
| Name |
MYOZ1 Antibody - middle region (ARP88448_P050) |
| Protein Size (# AA) |
299 amino acids |
| Molecular Weight |
32 kDa |
| NCBI Gene Id |
58529 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
myozenin 1 |
| Alias Symbols |
CS-2, FATZ, MYOZ |
| Peptide Sequence |
Synthetic peptide located within the following region: DVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MYOZ1 (ARP88448_P050) antibody |
| Blocking Peptide |
For anti-MYOZ1 (ARP88448_P050) antibody is Catalog # AAP88448 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MYOZ1 |
| Uniprot ID |
Q9NP98 |
| Protein Name |
myozenin-1 |
| Protein Accession # |
NP_067068.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_021245.3 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MYOZ1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human DLD1 Whole Cell
 | Host: Rabbit
Target Name: MYOZ1
Sample Tissue: Human DLD1 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
