| Product Number |
ARP88307_P050 |
| Product Page |
www.avivasysbio.com/gchfr-antibody-middle-region-arp88307-p050.html |
| Name |
GCHFR Antibody - middle region (ARP88307_P050) |
| Protein Size (# AA) |
84 amino acids |
| Molecular Weight |
9 kDa |
| NCBI Gene Id |
2644 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
GTP cyclohydrolase I feedback regulator |
| Alias Symbols |
P35, GFRP, HsT16933 |
| Peptide Sequence |
Synthetic peptide located within the following region: PTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GCHFR (ARP88307_P050) antibody |
| Blocking Peptide |
For anti-GCHFR (ARP88307_P050) antibody is Catalog # AAP88307 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GCHFR |
| Uniprot ID |
P30047 |
| Protein Name |
GTP cyclohydrolase 1 feedback regulatory protein |
| Protein Accession # |
NP_005249.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_005258.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GCHFR |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human OVCAR-3 Whole Cell
 | Host: Rabbit
Target Name: GCHFR
Sample Tissue: Human OVCAR-3 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
