Product Number |
ARP88268_P050 |
Product Page |
www.avivasysbio.com/tnip2-antibody-c-terminal-region-arp88268-p050.html |
Name |
TNIP2 Antibody - C-terminal region (ARP88268_P050) |
Protein Size (# AA) |
322 amino acids |
Molecular Weight |
35 kDa |
NCBI Gene Id |
79155 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
TNFAIP3 interacting protein 2 |
Alias Symbols |
KLIP, ABIN2, FLIP1 |
Peptide Sequence |
Synthetic peptide located within the following region: DSREPDAGRIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a protein which acts as an inhibitor of NFkappaB activation. The encoded protein is also involved in MAP/ERK signaling pathway in specific cell types. It may be involved in apoptosis of endothelial cells. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TNIP2 (ARP88268_P050) antibody |
Blocking Peptide |
For anti-TNIP2 (ARP88268_P050) antibody is Catalog # AAP88268 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TNIP2 |
Uniprot ID |
Q8NFZ5-2 |
Protein Name |
TNFAIP3-interacting protein 2 |
Protein Accession # |
NP_001154999.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001161527.1 |
Tested Species Reactivity |
Human |
Gene Symbol |
TNIP2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human PANC1 Whole Cell
| Host: Rabbit Target Name: TNIP2 Sample Tissue: Human PANC1 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|