TNIP2 Antibody - C-terminal region (ARP88268_P050)

Data Sheet
 
Product Number ARP88268_P050
Product Page www.avivasysbio.com/tnip2-antibody-c-terminal-region-arp88268-p050.html
Name TNIP2 Antibody - C-terminal region (ARP88268_P050)
Protein Size (# AA) 322 amino acids
Molecular Weight 35 kDa
NCBI Gene Id 79155
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name TNFAIP3 interacting protein 2
Alias Symbols KLIP, ABIN2, FLIP1
Peptide Sequence Synthetic peptide located within the following region: DSREPDAGRIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a protein which acts as an inhibitor of NFkappaB activation. The encoded protein is also involved in MAP/ERK signaling pathway in specific cell types. It may be involved in apoptosis of endothelial cells. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TNIP2 (ARP88268_P050) antibody
Blocking Peptide For anti-TNIP2 (ARP88268_P050) antibody is Catalog # AAP88268
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TNIP2
Uniprot ID Q8NFZ5-2
Protein Name TNFAIP3-interacting protein 2
Protein Accession # NP_001154999.1
Purification Affinity purified
Nucleotide Accession # NM_001161527.1
Tested Species Reactivity Human
Gene Symbol TNIP2
Predicted Species Reactivity Human
Application WB
Image 1
Human PANC1 Whole Cell
Host: Rabbit
Target Name: TNIP2
Sample Tissue: Human PANC1 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com