| Product Number |
ARP88227_P050 |
| Product Page |
www.avivasysbio.com/nup88-antibody-middle-region-arp88227-p050.html |
| Name |
NUP88 Antibody - middle region (ARP88227_P050) |
| Protein Size (# AA) |
741 amino acids |
| Molecular Weight |
81 kDa |
| NCBI Gene Id |
4927 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
nucleoporin 88 |
| Alias Symbols |
FADS4 |
| Peptide Sequence |
Synthetic peptide located within the following region: NYGYDACAVLCLPCVPNILVIATESGMLYHCVVLEGEEEDDHTSEKSWDS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins, a family of 50 to 100 proteins, are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene belongs to the nucleoporin family and is associated with the oncogenic nucleoporin CAN/Nup214 in a dynamic subcomplex. This protein is also overexpressed in a large number of malignant neoplasms and precancerous dysplasias. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NUP88 (ARP88227_P050) antibody |
| Blocking Peptide |
For anti-NUP88 (ARP88227_P050) antibody is Catalog # AAP88227 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NUP88 |
| Uniprot ID |
Q99567 |
| Protein Name |
Nuclear pore complex protein Nup88 |
| Protein Accession # |
NP_001307582.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001320653.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NUP88 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human ACHN Whole Cell
 | Host: Rabbit
Target Name: NUP88
Sample Tissue: Human ACHN Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
