SNAPIN Antibody - C-terminal region (ARP88211_P050)

Data Sheet
 
Product Number ARP88211_P050
Product Page www.avivasysbio.com/snapin-antibody-c-terminal-region-arp88211-p050.html
Product Name SNAPIN Antibody - C-terminal region (ARP88211_P050)
Size 100 ul
Gene Symbol SNAPIN
Alias Symbols BLOS7, SNAPAP, BLOC1S7
Protein Size (# AA) 136 amino acids
Molecular Weight 14 kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 23557
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name SNAP associated protein
Peptide Sequence Synthetic peptide located within the following region: LLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSP
Description of Target The protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-SNAPIN (ARP88211_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 24 hours delivery International: 3-5 business days
Blocking Peptide For anti-SNAPIN (ARP88211_P050) antibody is Catalog # AAP88211
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SNAPIN
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SNAPIN.
Swissprot Id O95295
Protein Name SNARE-associated protein Snapin
Protein Accession # NP_036569.1
Purification Affinity purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SNAPIN.
Nucleotide Accession # NM_012437.5
Tested Species Reactivity Human
Predicted Species Reactivity Human
Application WB
Image 1
Human A172 Whole Cell
Host: Rabbit
Target Name: SNAPIN
Sample Tissue: Human A172 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com