Product Number |
ARP88193_P050 |
Product Page |
www.avivasysbio.com/ppargc1b-antibody-n-terminal-region-arp88193-p050.html |
Name |
PPARGC1B Antibody - N-terminal region (ARP88193_P050) |
Protein Size (# AA) |
1023 amino acids |
Molecular Weight |
112 kDa |
NCBI Gene Id |
133522 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
PPARG coactivator 1 beta |
Alias Symbols |
PERC, ERRL1, PGC1B, PGC-1(beta) |
Peptide Sequence |
Synthetic peptide located within the following region: LSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The protein encoded by this gene stimulates the activity of several transcription factors and nuclear receptors, including estrogen receptor alpha, nuclear respiratory factor 1, and glucocorticoid receptor. The encoded protein may be involved in fat oxidation, non-oxidative glucose metabolism, and the regulation of energy expenditure. This protein is downregulated in prediabetic and type 2 diabetes mellitus patients. Certain allelic variations in this gene increase the risk of the development of obesity. Three transcript variants encoding different isoforms have been found for this gene. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PPARGC1B (ARP88193_P050) antibody |
Blocking Peptide |
For anti-PPARGC1B (ARP88193_P050) antibody is Catalog # AAP88193 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1B |
Uniprot ID |
Q86YN6 |
Protein Name |
Peroxisome proliferator-activated receptor gamma coactivator 1-beta |
Protein Accession # |
NP_001166169.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001172698.1 |
Tested Species Reactivity |
Human |
Gene Symbol |
PPARGC1B |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human THP-1 Whole Cell
| Host: Rabbit Target Name: PPARGC1B Sample Tissue: Human THP-1 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|