PPARGC1B Antibody - N-terminal region (ARP88193_P050)

Data Sheet
 
Product Number ARP88193_P050
Product Page www.avivasysbio.com/ppargc1b-antibody-n-terminal-region-arp88193-p050.html
Name PPARGC1B Antibody - N-terminal region (ARP88193_P050)
Protein Size (# AA) 1023 amino acids
Molecular Weight 112 kDa
NCBI Gene Id 133522
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name PPARG coactivator 1 beta
Alias Symbols PERC, ERRL1, PGC1B, PGC-1(beta)
Peptide Sequence Synthetic peptide located within the following region: LSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene stimulates the activity of several transcription factors and nuclear receptors, including estrogen receptor alpha, nuclear respiratory factor 1, and glucocorticoid receptor. The encoded protein may be involved in fat oxidation, non-oxidative glucose metabolism, and the regulation of energy expenditure. This protein is downregulated in prediabetic and type 2 diabetes mellitus patients. Certain allelic variations in this gene increase the risk of the development of obesity. Three transcript variants encoding different isoforms have been found for this gene.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PPARGC1B (ARP88193_P050) antibody
Blocking Peptide For anti-PPARGC1B (ARP88193_P050) antibody is Catalog # AAP88193
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1B
Uniprot ID Q86YN6
Protein Name Peroxisome proliferator-activated receptor gamma coactivator 1-beta
Protein Accession # NP_001166169.1
Purification Affinity purified
Nucleotide Accession # NM_001172698.1
Tested Species Reactivity Human
Gene Symbol PPARGC1B
Predicted Species Reactivity Human
Application WB
Image 1
Human THP-1 Whole Cell
Host: Rabbit
Target Name: PPARGC1B
Sample Tissue: Human THP-1 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com