Product Number |
ARP88144_P050 |
Product Page |
www.avivasysbio.com/khdrbs1-antibody-middle-region-arp88144-p050.html |
Name |
KHDRBS1 Antibody - middle region (ARP88144_P050) |
Protein Size (# AA) |
443 amino acids |
Molecular Weight |
48 kDa |
NCBI Gene Id |
10657 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
KH domain containing, RNA binding, signal transduction associated 1 |
Alias Symbols |
p62, p68, Sam68 |
Peptide Sequence |
Synthetic peptide located within the following region: LTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a member of the K homology domain-containing, RNA-binding, signal transduction-associated protein family. The encoded protein appears to have many functions and may be involved in a variety of cellular processes, including alternative splicing, cell cycle regulation, RNA 3'-end formation, tumorigenesis, and regulation of human immunodeficiency virus gene expression. Alternative splicing results in multiple transcript variants. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KHDRBS1 (ARP88144_P050) antibody |
Blocking Peptide |
For anti-KHDRBS1 (ARP88144_P050) antibody is Catalog # AAP88144 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human KHDRBS1 |
Uniprot ID |
Q07666 |
Protein Name |
KH domain-containing, RNA-binding, signal transduction-associated protein 1 |
Protein Accession # |
NP_001258807.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001271878.1 |
Tested Species Reactivity |
Human |
Gene Symbol |
KHDRBS1 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human DLD1 Whole Cell
| Host: Rabbit Target Name: KHDRBS1 Sample Tissue: Human DLD1 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|