KHDRBS1 Antibody - middle region (ARP88144_P050)

Data Sheet
 
Product Number ARP88144_P050
Product Page www.avivasysbio.com/khdrbs1-antibody-middle-region-arp88144-p050.html
Name KHDRBS1 Antibody - middle region (ARP88144_P050)
Protein Size (# AA) 443 amino acids
Molecular Weight 48 kDa
NCBI Gene Id 10657
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name KH domain containing, RNA binding, signal transduction associated 1
Alias Symbols p62, p68, Sam68
Peptide Sequence Synthetic peptide located within the following region: LTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the K homology domain-containing, RNA-binding, signal transduction-associated protein family. The encoded protein appears to have many functions and may be involved in a variety of cellular processes, including alternative splicing, cell cycle regulation, RNA 3'-end formation, tumorigenesis, and regulation of human immunodeficiency virus gene expression. Alternative splicing results in multiple transcript variants.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KHDRBS1 (ARP88144_P050) antibody
Blocking Peptide For anti-KHDRBS1 (ARP88144_P050) antibody is Catalog # AAP88144
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KHDRBS1
Uniprot ID Q07666
Protein Name KH domain-containing, RNA-binding, signal transduction-associated protein 1
Protein Accession # NP_001258807.1
Purification Affinity purified
Nucleotide Accession # NM_001271878.1
Tested Species Reactivity Human
Gene Symbol KHDRBS1
Predicted Species Reactivity Human
Application WB
Image 1
Human DLD1 Whole Cell
Host: Rabbit
Target Name: KHDRBS1
Sample Tissue: Human DLD1 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com