| Product Number |
ARP88021_P050 |
| Product Page |
www.avivasysbio.com/ski-antibody-middle-region-arp88021-p050.html |
| Name |
SKI Antibody - middle region (ARP88021_P050) |
| Protein Size (# AA) |
728 amino acids |
| Molecular Weight |
80 kDa |
| NCBI Gene Id |
6497 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SKI proto-oncogene |
| Alias Symbols |
SGS, SKV |
| Peptide Sequence |
Synthetic peptide located within the following region: TDDTSSQSPAPSEKDKPSSWLRTLAGSSNKSLGCVHPRQRLSAFRPWSPA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes the nuclear protooncogene protein homolog of avian sarcoma viral (v-ski) oncogene. It functions as a repressor of TGF-beta signaling, and may play a role in neural tube development and muscle differentiation. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SKI (ARP88021_P050) antibody |
| Blocking Peptide |
For anti-SKI (ARP88021_P050) antibody is Catalog # AAP88021 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SKI |
| Uniprot ID |
P12755 |
| Protein Name |
ski oncogene |
| Protein Accession # |
NP_003027.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_003036.3 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SKI |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human HepG2 Whole Cell
 | Host: Rabbit
Target Name: SKI
Sample Tissue: Human HepG2 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
