| Product Number |
ARP87926_P050 |
| Product Page |
www.avivasysbio.com/cip2a-antibody-middle-region-arp87926-p050.html |
| Name |
CIP2A Antibody - middle region (ARP87926_P050) |
| Protein Size (# AA) |
746 amino acids |
| Molecular Weight |
85 kDa |
| NCBI Gene Id |
57650 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
cell proliferation regulating inhibitor of protein phosphatase 2A |
| Alias Symbols |
p90, NOCIVA, KIAA1524 |
| Peptide Sequence |
Synthetic peptide located within the following region: MDLLKNPKIADYLTRYEHFSSCLHQVLGLLNGKDPDSSSKVLELLLAFCS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CIP2A (ARP87926_P050) antibody |
| Blocking Peptide |
For anti-CIP2A (ARP87926_P050) antibody is Catalog # AAP87926 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human KIAA1524 |
| Uniprot ID |
Q8TCG1-2 |
| Protein Name |
protein CIP2A |
| Protein Accession # |
NP_065941.2 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_020890.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CIP2A |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human PANC1 Whole Cell
 | Host: Rabbit
Target Name: KIAA1524
Sample Tissue: Human PANC1 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
