TACC2 Antibody - middle region (ARP87820_P050)

• Product Number: ARP87820_P050
• Name: TACC2 Antibody - middle region (ARP87820_P050)
• Protein Size (# AA): 571 amino acids
• Molecular Weight: 62 kDa
• NCBI Gene Id: 10579
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: transforming acidic coiled-coil containing protein 2
• Alias Symbols: AZU-1, ECTACC
• Peptide Sequence: Synthetic peptide located within the following region: KSPKRSPLSDPPSQDPTPAATPETPPVISAVVHATDEEKLAVTNQKWTCM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Transforming acidic coiled-coil proteins are a conserved family of centrosome- and microtubule-interacting proteins that are implicated in cancer. This gene encodes a protein that concentrates at centrosomes throughout the cell cycle. This gene lies within a chromosomal region associated with tumorigenesis. Expression of this gene is induced by erythropoietin and is thought to affect the progression of breast tumors. Several transcript variants encoding different isoforms have been found for this gene.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TACC2 (ARP87820_P050) antibody is Catalog # AAP87820
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TACC2
• Uniprot ID: O95359-2
• Protein Name: transforming acidic coiled-coil-containing protein 2
• Protein Accession #: NP_001278807.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_001291878.1
• Tested Species Reactivity: Human
• Gene Symbol: TACC2
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human 786-0 Whole Cell
  
  Host: Rabbit
  Target Name: TACC2
  Sample Tissue: Human 786-0 Whole Cell lysates
  Antibody Dilution: 1ug/ml