| Product Number |
ARP87548_P050 |
| Product Page |
www.avivasysbio.com/aipl1-antibody-middle-region-arp87548-p050.html |
| Name |
AIPL1 Antibody - middle region (ARP87548_P050) |
| Protein Size (# AA) |
384 amino acids |
| Molecular Weight |
42 kDa |
| NCBI Gene Id |
23746 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
aryl hydrocarbon receptor interacting protein-like 1 |
| Alias Symbols |
LCA4, AIPL2 |
| Peptide Sequence |
Synthetic peptide located within the following region: WHVHTCGLANMFAYHTLGYEDLDELQKEPQPLVFVIELLQVDAPSDYQRE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Leber congenital amaurosis (LCA) is the most severe inherited retinopathy with the earliest age of onset and accounts for at least 5% of all inherited retinal diseases. Affected individuals are diagnosed at birth or in the first few months of life with nystagmus, severely impaired vision or blindness and an abnormal or flat electroretinogram. The photoreceptor/pineal-expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, is located within the LCA4 candidate region. The encoded protein contains three tetratricopeptide motifs, consistent with chaperone or nuclear transport activity. Mutations in this gene may cause approximately 20% of recessive LCA. Alternative splicing results in multiple transcript variants. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-AIPL1 (ARP87548_P050) antibody |
| Blocking Peptide |
For anti-AIPL1 (ARP87548_P050) antibody is Catalog # AAP87548 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human AIPL1 |
| Uniprot ID |
Q9NZN9 |
| Protein Name |
aryl-hydrocarbon-interacting protein-like 1 |
| Protein Accession # |
NP_001028226.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001033054.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
AIPL1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human 786-0 Whole Cell
 | Host: Rabbit
Target Name: AIPL1
Sample Tissue: Human 786-0 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
