HDGF Antibody - middle region (ARP87531_P050)

• Product Number: ARP87531_P050
• Name: HDGF Antibody - middle region (ARP87531_P050)
• Protein Size (# AA): 233 amino acids
• Molecular Weight: 25 kDa
• NCBI Gene Id: 3068
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: hepatoma-derived growth factor
• Alias Symbols: HMG1L2
• Peptide Sequence: Synthetic peptide located within the following region: THETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. This gene was thought initially to be located on chromosome X; however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HDGF (ARP87531_P050) antibody is Catalog # AAP87531
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of Human HDGF
• Uniprot ID: P51858-2
• Protein Name: hepatoma-derived growth factor
• Protein Accession #: NP_001119522.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_001126050.1
• Tested Species Reactivity: Human
• Gene Symbol: HDGF
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Hela Whole Cell
  
  Host: Rabbit
  Target Name: HDGF
  Sample Tissue: Human Hela Whole Cell lysates
  Antibody Dilution: 1ug/ml