Product Number |
ARP87354_P050 |
Product Page |
www.avivasysbio.com/akt2-antibody-middle-region-arp87354-p050.html |
Name |
AKT2 Antibody - middle region (ARP87354_P050) |
Protein Size (# AA) |
438 amino acids |
Molecular Weight |
48 kDa |
NCBI Gene Id |
208 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
v-akt murine thymoma viral oncogene homolog 2 |
Alias Symbols |
PKBB, PRKBB, HIHGHH, PKBBETA, RAC-BETA |
Peptide Sequence |
Synthetic peptide located within the following region: NQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 of 15 primary ovarian tumors. Overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-AKT2 (ARP87354_P050) antibody |
Blocking Peptide |
For anti-AKT2 (ARP87354_P050) antibody is Catalog # AAP87354 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human AKT2 |
Uniprot ID |
P31751-2 |
Protein Name |
RAC-beta serine/threonine-protein kinase |
Protein Accession # |
NP_001617.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001626.5 |
Tested Species Reactivity |
Human |
Gene Symbol |
AKT2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human Hela Whole Cell
| Host: Rabbit Target Name: AKT2 Sample Tissue: Human Hela Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|