AKT2 Antibody - middle region (ARP87354_P050)

Data Sheet
 
Product Number ARP87354_P050
Product Page www.avivasysbio.com/akt2-antibody-middle-region-arp87354-p050.html
Name AKT2 Antibody - middle region (ARP87354_P050)
Protein Size (# AA) 438 amino acids
Molecular Weight 48 kDa
NCBI Gene Id 208
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name v-akt murine thymoma viral oncogene homolog 2
Alias Symbols PKBB, PRKBB, HIHGHH, PKBBETA, RAC-BETA
Peptide Sequence Synthetic peptide located within the following region: NQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene is a putative oncogene encoding a protein belonging to a subfamily of serine/threonine kinases containing SH2-like (Src homology 2-like) domains. The gene was shown to be amplified and overexpressed in 2 of 8 ovarian carcinoma cell lines and 2 of 15 primary ovarian tumors. Overexpression contributes to the malignant phenotype of a subset of human ductal pancreatic cancers. The encoded protein is a general protein kinase capable of phophorylating several known proteins.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-AKT2 (ARP87354_P050) antibody
Blocking Peptide For anti-AKT2 (ARP87354_P050) antibody is Catalog # AAP87354
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human AKT2
Uniprot ID P31751-2
Protein Name RAC-beta serine/threonine-protein kinase
Protein Accession # NP_001617.1
Purification Affinity purified
Nucleotide Accession # NM_001626.5
Tested Species Reactivity Human
Gene Symbol AKT2
Predicted Species Reactivity Human
Application WB
Image 1
Human Hela Whole Cell
Host: Rabbit
Target Name: AKT2
Sample Tissue: Human Hela Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com