| Product Number |
ARP87103_P050 |
| Product Page |
www.avivasysbio.com/rhoc-antibody-middle-region-arp87103-p050.html |
| Name |
RHOC Antibody - middle region (ARP87103_P050) |
| Protein Size (# AA) |
193 amino acids |
| Molecular Weight |
21 kDa |
| NCBI Gene Id |
389 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ras homolog family member C |
| Alias Symbols |
H9, ARH9, ARHC, RHOH9 |
| Peptide Sequence |
Synthetic peptide located within the following region: LVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RHOC (ARP87103_P050) antibody |
| Blocking Peptide |
For anti-RHOC (ARP87103_P050) antibody is Catalog # AAP87103 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RHOC |
| Uniprot ID |
P08134 |
| Protein Name |
Rho-related GTP-binding protein RhoC |
| Protein Accession # |
NP_001036143.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001042678.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RHOC |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human THP-1 Whole Cell
 | Host: Rabbit
Target Name: RHOC
Sample Tissue: Human THP-1 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
