Product Number |
ARP87102_P050 |
Product Page |
www.avivasysbio.com/cttn-antibody-middle-region-arp87102-p050.html |
Name |
CTTN Antibody - middle region (ARP87102_P050) |
Protein Size (# AA) |
634 amino acids |
Molecular Weight |
71 kDa |
NCBI Gene Id |
2017 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
cortactin |
Alias Symbols |
EMS1 |
Peptide Sequence |
Synthetic peptide located within the following region: KDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CTTN (ARP87102_P050) antibody |
Blocking Peptide |
For anti-CTTN (ARP87102_P050) antibody is Catalog # AAP87102 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CTTN |
Uniprot ID |
Q14247-2 |
Protein Name |
src substrate cortactin |
Protein Accession # |
NP_001171669.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001184740.1 |
Tested Species Reactivity |
Human |
Gene Symbol |
CTTN |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human OVCAR-3 Whole Cell
| Host: Rabbit Target Name: CTTN Sample Tissue: Human OVCAR-3 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|