CTTN Antibody - middle region (ARP87102_P050)

Data Sheet
 
Product Number ARP87102_P050
Product Page www.avivasysbio.com/cttn-antibody-middle-region-arp87102-p050.html
Name CTTN Antibody - middle region (ARP87102_P050)
Protein Size (# AA) 634 amino acids
Molecular Weight 71 kDa
NCBI Gene Id 2017
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name cortactin
Alias Symbols EMS1
Peptide Sequence Synthetic peptide located within the following region: KDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CTTN (ARP87102_P050) antibody
Blocking Peptide For anti-CTTN (ARP87102_P050) antibody is Catalog # AAP87102
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CTTN
Uniprot ID Q14247-2
Protein Name src substrate cortactin
Protein Accession # NP_001171669.1
Purification Affinity purified
Nucleotide Accession # NM_001184740.1
Tested Species Reactivity Human
Gene Symbol CTTN
Predicted Species Reactivity Human
Application WB
Image 1
Human OVCAR-3 Whole Cell
Host: Rabbit
Target Name: CTTN
Sample Tissue: Human OVCAR-3 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com