RRM2 Antibody - C-terminal region (ARP87047_P050)

• Product Number: ARP87047_P050
• Name: RRM2 Antibody - C-terminal region (ARP87047_P050)
• Protein Size (# AA): 389 amino acids
• Molecular Weight: 42 kDa
• NCBI Gene Id: 6241
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ribonucleotide reductase regulatory subunit M2
• Alias Symbols: R2, RR2, RR2M, C2orf48
• Peptide Sequence: Synthetic peptide located within the following region: QYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTNFFEKRVGEYQR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RRM2 (ARP87047_P050) antibody is Catalog # AAP87047
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RRM2
• Uniprot ID: P31350
• Protein Name: Ribonucleoside-diphosphate reductase subunit M2
• Protein Accession #: NP_001025.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_001034.3
• Tested Species Reactivity: Human
• Gene Symbol: RRM2
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human 293T Whole Cell
  
  Host: Rabbit
  Target Name: RRM2
  Sample Tissue: Human 293T Whole Cell lysates
  Antibody Dilution: 1ug/ml