| Product Number |
ARP86964_P050 |
| Product Page |
www.avivasysbio.com/ace2-antibody-c-terminal-region-arp86964-p050.html |
| Name |
ACE2 Antibody - C-terminal region (ARP86964_P050) |
| Protein Size (# AA) |
805 amino acids |
| Molecular Weight |
88 kDa |
| NCBI Gene Id |
59272 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
angiotensin I converting enzyme 2 |
| Alias Symbols |
ACEH |
| Peptide Sequence |
Synthetic peptide located within the following region: PNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENPYAS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I into angiotensin 1-9, and angiotensin II into the vasodilator angiotensin 1-7. The organ- and cell-specific expression of this gene suggests that it may play a role in the regulation of cardiovascular and renal function, as well as fertility. In addition, the encoded protein is a functional receptor for the spike glycoprotein of the human coronaviruses SARS and HCoV-NL63. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ACE2 (ARP86964_P050) antibody |
| Blocking Peptide |
For anti-ACE2 (ARP86964_P050) antibody is Catalog # AAP86964 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ACE2 |
| Uniprot ID |
Q9BYF1 |
| Protein Name |
Angiotensin-converting enzyme 2 |
| Protein Accession # |
NP_068576.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_021804.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ACE2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human COLO205 Whole Cell
 | Host: Rabbit
Target Name: ACE2
Sample Tissue: Human COLO205 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
