XRCC6 Antibody - N-terminal region (ARP86959_P050)

• Product Number: ARP86959_P050
• Name: XRCC6 Antibody - N-terminal region (ARP86959_P050)
• Protein Size (# AA): 609 amino acids
• Molecular Weight: 70 kDa
• NCBI Gene Id: 2547
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: X-ray repair cross complementing 6
• Alias Symbols: ML8, KU70, TLAA, CTC75, CTCBF, G22P1
• Peptide Sequence: Synthetic peptide located within the following region: SSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-XRCC6 (ARP86959_P050) antibody is Catalog # AAP86959
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human XRCC6
• Uniprot ID: P12956
• Protein Name: X-ray repair cross-complementing protein 6
• Protein Accession #: NP_001275905.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_001288976.1
• Tested Species Reactivity: Human
• Gene Symbol: XRCC6
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: XRCC6
  Sample Tissue: Human Jurkat Whole Cell lysates
  Antibody Dilution: 1ug/ml