BECN1 Antibody - N-terminal region (ARP86768_P050)

Data Sheet
 
Product Number ARP86768_P050
Product Page www.avivasysbio.com/becn1-antibody-n-terminal-region-arp86768-p050.html
Name BECN1 Antibody - N-terminal region (ARP86768_P050)
Protein Size (# AA) 450 amino acids
Molecular Weight 52 kDa
NCBI Gene Id 8678
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name beclin 1
Alias Symbols ATG6, VPS30, beclin1
Peptide Sequence Synthetic peptide located within the following region: TTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-BECN1 (ARP86768_P050) antibody
Blocking Peptide For anti-BECN1 (ARP86768_P050) antibody is Catalog # AAP86768
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of Human BECN1
Uniprot ID Q14457
Protein Name Beclin-1
Protein Accession # NP_001300927.1
Purification Affinity purified
Nucleotide Accession # NM_001313998.1
Tested Species Reactivity Human
Gene Symbol BECN1
Predicted Species Reactivity Human
Application WB
Image 1
Human Jurkat Whole Cell
Host: Rabbit
Target Name: BECN1
Sample Tissue: Human Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com