| Product Number |
ARP86385_P050 |
| Product Page |
www.avivasysbio.com/wdr4-antibody-middle-region-arp86385-p050.html |
| Name |
WDR4 Antibody - middle region (ARP86385_P050) |
| Protein Size (# AA) |
412 amino acids |
| Molecular Weight |
45 kDa |
| NCBI Gene Id |
10785 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
WD repeat domain 4 |
| Alias Symbols |
hWH, Wuho, MIGSB, TRM82, GAMOS6, TRMT82 |
| Peptide Sequence |
Synthetic peptide located within the following region: TEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Alternatively spliced transcript variants have been found for this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-WDR4 (ARP86385_P050) antibody |
| Blocking Peptide |
For anti-WDR4 (ARP86385_P050) antibody is Catalog # AAP86385 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human WDR4 |
| Uniprot ID |
P57081 |
| Protein Name |
tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4 |
| Protein Accession # |
NP_001247403.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001260474.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
WDR4 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Jurkat Whole Cell
 | Host: Rabbit
Target Name: WDR4
Sample Tissue: Human Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
