| Product Number |
ARP85738_P050 |
| Product Page |
www.avivasysbio.com/tyw1-antibody-c-terminal-region-arp85738-p050.html |
| Name |
TYW1 Antibody - C-terminal region (ARP85738_P050) |
| Protein Size (# AA) |
294 amino acids |
| Molecular Weight |
34 kDa |
| NCBI Gene Id |
55253 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
tRNA-yW synthesizing protein 1 homolog |
| Alias Symbols |
TYW1A, RSAFD1, YPL207W |
| Peptide Sequence |
Synthetic peptide located within the following region: EYEDSGGSKTFSAKDYMARTPHWALFGASERGFDPKDTRHQRKNKSKAIS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Wybutosine (yW) is a hypermodified guanosine found in phenylalanine tRNA adjacent to the anticodon that stabilizes codon-anticodon interactions in the ribosome. In yeast, the homolog of this gene is essential for the synthesis of wybutosine. Alternative splicing results in multiple transcript variants. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TYW1 (ARP85738_P050) antibody |
| Blocking Peptide |
For anti-TYW1 (ARP85738_P050) antibody is Catalog # AAP85738 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TYW1 |
| Uniprot ID |
Q6NUM6-2 |
| Protein Name |
S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase |
| Protein Accession # |
NP_060734.2 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_018264.3 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TYW1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Uterus Tumor
 | Host: Rabbit
Target Name: TYW1
Sample Tissue: Human Uterus Tumor lysates
Antibody Dilution: 1ug/ml |
|
|
