| Product Number |
ARP85441_P050 |
| Product Page |
www.avivasysbio.com/rit2-antibody-middle-region-arp85441-p050.html |
| Name |
RIT2 Antibody - middle region (ARP85441_P050) |
| Protein Size (# AA) |
236 amino acids |
| Molecular Weight |
25 kDa |
| NCBI Gene Id |
6014 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ras-like without CAAX 2 |
| Alias Symbols |
RIN, RIBA, ROC2 |
| Peptide Sequence |
Synthetic peptide located within the following region: GVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
RIN belongs to the RAS superfamily of small GTPases. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RIT2 (ARP85441_P050) antibody |
| Blocking Peptide |
For anti-RIT2 (ARP85441_P050) antibody is Catalog # AAP85441 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RIT2 |
| Uniprot ID |
Q92963-3 |
| Protein Name |
GTP-binding protein Rit2 |
| Protein Accession # |
NP_001259006.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001272077.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RIT2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human MCF7 Whole Cell
 | Host: Rabbit
Target Name: RIT2
Sample Tissue: Human MCF7 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
