SLC4A8 Antibody - N-terminal region (ARP85341_P050)

• Product Number: ARP85341_P050
• Name: SLC4A8 Antibody - N-terminal region (ARP85341_P050)
• Protein Size (# AA): 747 amino acids
• Molecular Weight: 82 kDa
• NCBI Gene Id: 9498
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: solute carrier family 4, sodium bicarbonate cotransporter, member 8
• Alias Symbols: NBC3, NDCBE
• Peptide Sequence: Synthetic peptide located within the following region: LGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEALAHDTPSQRVQFILGT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene is a membrane protein that functions to transport sodium and bicarbonate ions across the cell membrane. The encoded protein is important for pH regulation in neurons. The activity of this protein can be inhibited by 4,4'-Di-isothiocyanatostilbene-2,2'-disulfonic acid (DIDS). Several transcript variants encoding different isoforms have been found for this gene.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLC4A8 (ARP85341_P050) antibody is Catalog # AAP85341
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC4A8
• Uniprot ID: Q2Y0W8-7
• Protein Name: electroneutral sodium bicarbonate exchanger 1
• Protein Accession #: NP_001035049.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_001039960.2
• Tested Species Reactivity: Human
• Gene Symbol: SLC4A8
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human K562 Whole Cell
  
  Host: Rabbit
  Target Name: SLC4A8
  Sample Tissue: Human K562 Whole Cell lysates
  Antibody Dilution: 1ug/ml