| Product Number |
ARP85259_P050 |
| Product Page |
www.avivasysbio.com/grhpr-antibody-middle-region-arp85259-p050.html |
| Name |
GRHPR Antibody - middle region (ARP85259_P050) |
| Protein Size (# AA) |
252 amino acids |
| Molecular Weight |
28 kDa |
| NCBI Gene Id |
9380 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
glyoxylate reductase/hydroxypyruvate reductase |
| Alias Symbols |
PH2, GLXR, GLYD |
| Peptide Sequence |
Synthetic peptide located within the following region: CGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes an enzyme with hydroxypyruvate reductase, glyoxylate reductase, and D-glycerate dehydrogenase enzymatic activities. The enzyme has widespread tissue expression and has a role in metabolism. Type II hyperoxaluria is caused by mutations in this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GRHPR (ARP85259_P050) antibody |
| Blocking Peptide |
For anti-GRHPR (ARP85259_P050) antibody is Catalog # AAP85259 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GRHPR |
| Uniprot ID |
Q9UBQ7-2 |
| Protein Name |
glyoxylate reductase/hydroxypyruvate reductase |
| Protein Accession # |
NP_036335.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_012203.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GRHPR |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Jurkat Whole Cell
 | Host: Rabbit
Target Name: GRHPR
Sample Tissue: Human Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
