Product Number |
ARP85243_P050 |
Product Page |
www.avivasysbio.com/slco4a1-antibody-middle-region-arp85243-p050.html |
Name |
SLCO4A1 Antibody - middle region (ARP85243_P050) |
Protein Size (# AA) |
722 amino acids |
Molecular Weight |
79 kDa |
NCBI Gene Id |
28231 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
solute carrier organic anion transporter family member 4A1 |
Alias Symbols |
POAT, OATP1, OATPE, OATP-E, OATP4A1, OATPRP1, SLC21A12 |
Peptide Sequence |
Synthetic peptide located within the following region: WWVGFLGSGAAAFFTAVPILGYPRQLPGSQRYAVMRAAEMHQLKDSSRGE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Mediates the Na+-independent transport of organic anions such as the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and of estrone-3-sulfate and taurocholate. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SLCO4A1 (ARP85243_P050) antibody |
Blocking Peptide |
For anti-SLCO4A1 (ARP85243_P050) antibody is Catalog # AAP85243 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SLCO4A1 |
Uniprot ID |
Q96BD0 |
Protein Name |
solute carrier organic anion transporter family member 4A1 |
Protein Accession # |
NP_057438.3 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_016354.3 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLCO4A1 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human COLO205 Whole Cell
| Host: Rabbit Target Name: SLCO4A1 Sample Tissue: Human COLO205 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|