Product Number |
ARP85040_P050 |
Product Page |
www.avivasysbio.com/mapk9-antibody-c-terminal-region-arp85040-p050.html |
Name |
MAPK9 Antibody - C-terminal region (ARP85040_P050) |
Protein Size (# AA) |
382 amino acids |
Molecular Weight |
42 kDa |
NCBI Gene Id |
5601 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
mitogen-activated protein kinase 9 |
Alias Symbols |
JNK2, SAPK, p54a, JNK2A, JNK2B, PRKM9, JNK-55, SAPK1a, JNK2BETA, p54aSAPK, JNK2ALPHA |
Peptide Sequence |
Synthetic peptide located within the following region: QIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. This gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MAPK9 (ARP85040_P050) antibody |
Blocking Peptide |
For anti-MAPK9 (ARP85040_P050) antibody is Catalog # AAP85040 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human MAPK9 |
Uniprot ID |
P45984-2 |
Protein Name |
mitogen-activated protein kinase 9 |
Protein Accession # |
NP_001128516.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001135044.1 |
Tested Species Reactivity |
Human |
Gene Symbol |
MAPK9 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human Neurofibroma Tumor
| Host: Rabbit Target Name: MAPK9 Sample Tissue: Human Neurofibroma Tumor lysates Antibody Dilution: 1ug/ml |
|
|