MAPK9 Antibody - C-terminal region (ARP85040_P050)

Data Sheet
 
Product Number ARP85040_P050
Product Page www.avivasysbio.com/mapk9-antibody-c-terminal-region-arp85040-p050.html
Name MAPK9 Antibody - C-terminal region (ARP85040_P050)
Protein Size (# AA) 382 amino acids
Molecular Weight 42 kDa
NCBI Gene Id 5601
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name mitogen-activated protein kinase 9
Alias Symbols JNK2, SAPK, p54a, JNK2A, JNK2B, PRKM9, JNK-55, SAPK1a, JNK2BETA, p54aSAPK, JNK2ALPHA
Peptide Sequence Synthetic peptide located within the following region: QIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. This gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MAPK9 (ARP85040_P050) antibody
Blocking Peptide For anti-MAPK9 (ARP85040_P050) antibody is Catalog # AAP85040
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MAPK9
Uniprot ID P45984-2
Protein Name mitogen-activated protein kinase 9
Protein Accession # NP_001128516.1
Purification Affinity purified
Nucleotide Accession # NM_001135044.1
Tested Species Reactivity Human
Gene Symbol MAPK9
Predicted Species Reactivity Human
Application WB
Image 1
Human Neurofibroma Tumor
Host: Rabbit
Target Name: MAPK9
Sample Tissue: Human Neurofibroma Tumor lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com