Product Number |
ARP84992_P050 |
Product Page |
www.avivasysbio.com/snx2-antibody-middle-region-arp84992-p050.html |
Name |
SNX2 Antibody - middle region (ARP84992_P050) |
Protein Size (# AA) |
402 amino acids |
Molecular Weight |
44 kDa |
NCBI Gene Id |
6643 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
sorting nexin 2 |
Alias Symbols |
TRG-9 |
Peptide Sequence |
Synthetic peptide located within the following region: REAEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene belongs to the sorting nexin family whose members contain the phosphoinositide-binding phox (PX) domain. The encoded protein is a component of the retromer complex which plays a role in protein sorting in the endocytic pathway. This protein may form oligomeric complexes with other family members. Alternate splicing results in multiple transcript variants of this gene. Pseudogenes associated with this gene are located on chromosomes 1 and 7. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SNX2 (ARP84992_P050) antibody |
Blocking Peptide |
For anti-SNX2 (ARP84992_P050) antibody is Catalog # AAP84992 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SNX2 |
Uniprot ID |
O60749-2 |
Protein Name |
sorting nexin-2 |
Protein Accession # |
NP_001265128.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001278199.1 |
Tested Species Reactivity |
Human |
Gene Symbol |
SNX2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human MCF7 Whole Cell
| Host: Rabbit Target Name: SNX2 Sample Tissue: Human MCF7 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|