SNX2 Antibody - middle region (ARP84992_P050)

Data Sheet
 
Product Number ARP84992_P050
Product Page www.avivasysbio.com/snx2-antibody-middle-region-arp84992-p050.html
Name SNX2 Antibody - middle region (ARP84992_P050)
Protein Size (# AA) 402 amino acids
Molecular Weight 44 kDa
NCBI Gene Id 6643
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name sorting nexin 2
Alias Symbols TRG-9
Peptide Sequence Synthetic peptide located within the following region: REAEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene belongs to the sorting nexin family whose members contain the phosphoinositide-binding phox (PX) domain. The encoded protein is a component of the retromer complex which plays a role in protein sorting in the endocytic pathway. This protein may form oligomeric complexes with other family members. Alternate splicing results in multiple transcript variants of this gene. Pseudogenes associated with this gene are located on chromosomes 1 and 7.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SNX2 (ARP84992_P050) antibody
Blocking Peptide For anti-SNX2 (ARP84992_P050) antibody is Catalog # AAP84992
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SNX2
Uniprot ID O60749-2
Protein Name sorting nexin-2
Protein Accession # NP_001265128.1
Purification Affinity purified
Nucleotide Accession # NM_001278199.1
Tested Species Reactivity Human
Gene Symbol SNX2
Predicted Species Reactivity Human
Application WB
Image 1
Human MCF7 Whole Cell
Host: Rabbit
Target Name: SNX2
Sample Tissue: Human MCF7 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com