| Product Number |
ARP84947_P050 |
| Product Page |
www.avivasysbio.com/fgf12-antibody-c-terminal-region-arp84947-p050.html |
| Name |
FGF12 Antibody - C-terminal region (ARP84947_P050) |
| Protein Size (# AA) |
181 amino acids |
| Molecular Weight |
20 kDa |
| NCBI Gene Id |
2257 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
fibroblast growth factor 12 |
| Alias Symbols |
FHF1, DEE47, EIEE47, FGF12B |
| Peptide Sequence |
Synthetic peptide located within the following region: TKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FGF12 (ARP84947_P050) antibody |
| Blocking Peptide |
For anti-FGF12 (ARP84947_P050) antibody is Catalog # AAP84947 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human FGF12 |
| Uniprot ID |
P61328-2 |
| Protein Name |
fibroblast growth factor 12 |
| Protein Accession # |
NP_004104.3 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_004113.5 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FGF12 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Jurkat Whole Cell
 | Host: Rabbit
Target Name: FGF12
Sample Tissue: Human Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
