| Product Number |
ARP84936_P050 |
| Product Page |
www.avivasysbio.com/card14-antibody-middle-region-arp84936-p050.html |
| Name |
CARD14 Antibody - middle region (ARP84936_P050) |
| Protein Size (# AA) |
1004 amino acids |
| Molecular Weight |
110 kDa |
| NCBI Gene Id |
79092 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
caspase recruitment domain family member 14 |
| Alias Symbols |
PRP, PSS1, BIMP2, CARMA2, PSORS2 |
| Peptide Sequence |
Synthetic peptide located within the following region: QQCTVTRKPSSGGPQKLVRIVSMDKAKASPLRLSFDRGQLDPSRMEGSST |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a caspase recruitment domain-containing protein that is a member of the membrane-associated guanylate kinase (MAGUK) family of proteins. Members of this protein family are scaffold proteins that are involved in a diverse array of cellular processes including cellular adhesion, signal transduction and cell polarity control. This protein has been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. Alternate splicing results in multiple transcript variants. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CARD14 (ARP84936_P050) antibody |
| Blocking Peptide |
For anti-CARD14 (ARP84936_P050) antibody is Catalog # AAP84936 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CARD14 |
| Uniprot ID |
Q9BXL6 |
| Protein Name |
caspase recruitment domain-containing protein 14 |
| Protein Accession # |
NP_001244899.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001257970.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CARD14 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Neurofibroma Tumor
 | Host: Rabbit
Target Name: CARD14
Sample Tissue: Human Neurofibroma Tumor lysates
Antibody Dilution: 1ug/ml |
|
|
