EYA4 Antibody - middle region (ARP84780_P050)

Data Sheet
 
Product Number ARP84780_P050
Product Page www.avivasysbio.com/eya4-antibody-middle-region-arp84780-p050.html
Name EYA4 Antibody - middle region (ARP84780_P050)
Protein Size (# AA) 639 amino acids
Molecular Weight 70 kDa
NCBI Gene Id 2070
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name EYA transcriptional coactivator and phosphatase 4
Alias Symbols CMD1J, DFNA10
Peptide Sequence Synthetic peptide located within the following region: IKDLDERTCRSSGSKSRGRGRKNNPSPPPDSDLERVFVWDLDETIIVFHS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator through its protein phosphatase activity, and it may be important for eye development, and for continued function of the mature organ of Corti. Mutations in this gene are associated with postlingual, progressive, autosomal dominant hearing loss at the deafness, autosomal dominant non-syndromic sensorineural 10 locus. The encoded protein is also a putative oncogene that mediates DNA repair, apoptosis, and innate immunity following DNA damage, cellular damage, and viral attack. Defects in this gene are also associated with dilated cardiomyopathy 1J. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-EYA4 (ARP84780_P050) antibody
Blocking Peptide For anti-EYA4 (ARP84780_P050) antibody is Catalog # AAP84780
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EYA4
Uniprot ID O95677
Protein Name eyes absent homolog 4
Protein Accession # NP_001287941.1
Purification Affinity purified
Nucleotide Accession # NM_001301012.1
Tested Species Reactivity Human
Gene Symbol EYA4
Predicted Species Reactivity Human
Application WB
Image 1
Human Hela Whole Cell
Host: Rabbit
Target Name: EYA4
Sample Tissue: Human Hela Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com