| Product Number |
ARP84704_P050 |
| Product Page |
www.avivasysbio.com/dlx4-antibody-middle-region-arp84704-p050.html |
| Name |
DLX4 Antibody - middle region (ARP84704_P050) |
| Protein Size (# AA) |
240 amino acids |
| Molecular Weight |
26 kDa |
| NCBI Gene Id |
1748 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
distal-less homeobox 4 |
| Alias Symbols |
BP1, DLX7, DLX8, DLX9, OFC15 |
| Peptide Sequence |
Synthetic peptide located within the following region: LPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. Three transcript variants have been described for this gene, however, the full length nature of one variant has not been described. Studies of the two splice variants revealed that one encoded isoform functions as a repressor of the beta-globin gene while the other isoform lacks that function. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DLX4 (ARP84704_P050) antibody |
| Blocking Peptide |
For anti-DLX4 (ARP84704_P050) antibody is Catalog # AAP84704 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle terminal region of human DLX4 |
| Uniprot ID |
Q92988 |
| Protein Name |
homeobox protein DLX-4 |
| Protein Accession # |
NP_001925.2 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001934.3 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DLX4 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Du145 Whole Cell
 | Host: Rabbit
Target Name: DLX4
Sample Tissue: Human Du145 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
