GGA1 Antibody - C-terminal region (ARP84586_P050)

Data Sheet
 
Product Number ARP84586_P050
Product Page www.avivasysbio.com/gga1-antibody-c-terminal-region-arp84586-p050.html
Product Name GGA1 Antibody - C-terminal region (ARP84586_P050)
Size 100 ul
Gene Symbol GGA1
Protein Size (# AA) 639 amino acids
Molecular Weight 70 kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 26088
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name golgi-associated, gamma adaptin ear containing, ARF binding protein 1
Peptide Sequence Synthetic peptide located within the following region: PSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGS
Description of Target This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) protein family. Members of this family are ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-GGA1 (ARP84586_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 24 hours delivery International: 3-5 business days
Blocking Peptide For anti-GGA1 (ARP84586_P050) antibody is Catalog # AAP84586
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GGA1
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express GGA1.
Swissprot Id Q9UJY5
Protein Name ADP-ribosylation factor-binding protein GGA1
Protein Accession # NP_001001560.1
Purification Affinity purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express GGA1.
Nucleotide Accession # NM_001001560.2
Tested Species Reactivity Human
Predicted Species Reactivity Human
Application WB
Image 1
Human LN18 Whole Cell
Host: Rabbit
Target Name: GGA1
Sample Tissue: Human LN18 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com