| Product Number |
ARP84586_P050 |
| Product Page |
www.avivasysbio.com/gga1-antibody-c-terminal-region-arp84586-p050.html |
| Name |
GGA1 Antibody - C-terminal region (ARP84586_P050) |
| Protein Size (# AA) |
639 amino acids |
| Molecular Weight |
70 kDa |
| NCBI Gene Id |
26088 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
golgi-associated, gamma adaptin ear containing, ARF binding protein 1 |
| Peptide Sequence |
Synthetic peptide located within the following region: PSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) protein family. Members of this family are ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GGA1 (ARP84586_P050) antibody |
| Blocking Peptide |
For anti-GGA1 (ARP84586_P050) antibody is Catalog # AAP84586 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human GGA1 |
| Uniprot ID |
Q9UJY5 |
| Protein Name |
ADP-ribosylation factor-binding protein GGA1 |
| Protein Accession # |
NP_001001560.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001001560.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GGA1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human LN18 Whole Cell
 | Host: Rabbit
Target Name: GGA1
Sample Tissue: Human LN18 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
