ADSL Antibody - middle region (ARP84486_P050)

Data Sheet
 
Product Number ARP84486_P050
Product Page www.avivasysbio.com/adsl-antibody-middle-region-arp84486-p050.html
Product Name ADSL Antibody - middle region (ARP84486_P050)
Size 100 ul
Gene Symbol ADSL
Alias Symbols ASL, AMPS, ASASE
Protein Size (# AA) 484 amino acids
Molecular Weight 53 kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 158
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name adenylosuccinate lyase
Peptide Sequence Synthetic peptide located within the following region: ASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLAR
Description of Target The protein encoded by this gene belongs to the lyase 1 family. It is an essential enzyme involved in purine metabolism, and catalyzes two non-sequential reactions in the de novo purine biosynthetic pathway: the conversion of succinylaminoimidazole carboxamide ribotide (SAICAR) to aminoimidazole carboxamide ribotide (AICAR) and the conversion of adenylosuccinate (S-AMP) to adenosine monophosphate (AMP). Mutations in this gene are associated with adenylosuccinase deficiency (ADSLD), a disorder marked with psychomotor retardation, epilepsy or autistic features. Alternatively spliced transcript variants have been found for this gene.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-ADSL (ARP84486_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 24 hours delivery International: 3-5 business days
Blocking Peptide For anti-ADSL (ARP84486_P050) antibody is Catalog # AAP84486
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ADSL
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ADSL.
Swissprot Id P30566
Protein Name adenylosuccinate lyase
Protein Accession # NP_000017.1
Purification Affinity purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ADSL.
Nucleotide Accession # NM_000026.2
Tested Species Reactivity Human
Predicted Species Reactivity Human
Application WB
Image 1
Human Hela Whole Cell
Host: Rabbit
Target Name: ADSL
Sample Tissue: Human Hela Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com