| Product Number |
ARP84428_P050 |
| Product Page |
www.avivasysbio.com/itga6-antibody-n-terminal-region-arp84428-p050.html |
| Name |
ITGA6 Antibody - N-terminal region (ARP84428_P050) |
| Protein Size (# AA) |
954 amino acids |
| Molecular Weight |
104 kDa |
| NCBI Gene Id |
3655 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
integrin subunit alpha 6 |
| Alias Symbols |
CD49f, VLA-6, ITGA6B |
| Peptide Sequence |
Synthetic peptide located within the following region: QGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 6 subunit. This subunit may associate with a beta 1 or beta 4 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. The alpha 6 beta 4 integrin may promote tumorigenesis, while the alpha 6 beta 1 integrin may negatively regulate erbB2/HER2 signaling. Alternative splicing results in multiple transcript variants. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ITGA6 (ARP84428_P050) antibody |
| Blocking Peptide |
For anti-ITGA6 (ARP84428_P050) antibody is Catalog # AAP84428 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ITGA6 |
| Uniprot ID |
P23229-7 |
| Protein Name |
integrin alpha-6 |
| Protein Accession # |
NP_000201.2 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_000210.3 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ITGA6 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human 293T Whole Cell
 | Host: Rabbit
Target Name: ITGA6
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
