HDGF Antibody - middle region (ARP84389_P050)

Data Sheet
 
Product Number ARP84389_P050
Product Page www.avivasysbio.com/hdgf-antibody-middle-region-arp84389-p050.html
Name HDGF Antibody - middle region (ARP84389_P050)
Protein Size (# AA) 233 amino acids
Molecular Weight 25 kDa
NCBI Gene Id 3068
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name hepatoma-derived growth factor
Alias Symbols HMG1L2
Peptide Sequence Synthetic peptide located within the following region: VKASGYQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. This gene was thought initially to be located on chromosome X; however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HDGF (ARP84389_P050) antibody
Blocking Peptide For anti-HDGF (ARP84389_P050) antibody is Catalog # AAP84389
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HDGF
Uniprot ID P51858-2
Protein Name hepatoma-derived growth factor
Protein Accession # NP_001119522.1
Purification Affinity purified
Nucleotide Accession # NM_001126050.1
Tested Species Reactivity Human
Gene Symbol HDGF
Predicted Species Reactivity Human
Application WB
Image 1
Human THP-1 Whole Cell
Host: Rabbit
Target Name: HDGF
Sample Tissue: Human THP-1 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com