Product Number |
ARP84389_P050 |
Product Page |
www.avivasysbio.com/hdgf-antibody-middle-region-arp84389-p050.html |
Name |
HDGF Antibody - middle region (ARP84389_P050) |
Protein Size (# AA) |
233 amino acids |
Molecular Weight |
25 kDa |
NCBI Gene Id |
3068 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
hepatoma-derived growth factor |
Alias Symbols |
HMG1L2 |
Peptide Sequence |
Synthetic peptide located within the following region: VKASGYQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. This gene was thought initially to be located on chromosome X; however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HDGF (ARP84389_P050) antibody |
Blocking Peptide |
For anti-HDGF (ARP84389_P050) antibody is Catalog # AAP84389 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HDGF |
Uniprot ID |
P51858-2 |
Protein Name |
hepatoma-derived growth factor |
Protein Accession # |
NP_001119522.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001126050.1 |
Tested Species Reactivity |
Human |
Gene Symbol |
HDGF |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human THP-1 Whole Cell
| Host: Rabbit Target Name: HDGF Sample Tissue: Human THP-1 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|