| Product Number |
ARP84362_P050 |
| Product Page |
www.avivasysbio.com/srd5a1-antibody-middle-region-arp84362-p050.html |
| Name |
SRD5A1 Antibody - middle region (ARP84362_P050) |
| Protein Size (# AA) |
259 amino acids |
| Molecular Weight |
29 kDa |
| NCBI Gene Id |
6715 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
steroid 5 alpha-reductase 1 |
| Alias Symbols |
S5AR 1 |
| Peptide Sequence |
Synthetic peptide located within the following region: GMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Steroid 5-alpha-reductase catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SRD5A1 (ARP84362_P050) antibody |
| Blocking Peptide |
For anti-SRD5A1 (ARP84362_P050) antibody is Catalog # AAP84362 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SRD5A1 |
| Uniprot ID |
P18405 |
| Protein Name |
3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
| Protein Accession # |
NP_001038.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001047.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SRD5A1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human HCT116 Whole Cell
 | Host: Rabbit
Target Name: SRD5A1
Sample Tissue: Human HCT116 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
