DYM Antibody - middle region (ARP84298_P050)

Data Sheet
 
Product Number ARP84298_P050
Product Page www.avivasysbio.com/dym-antibody-middle-region-arp84298-p050.html
Name DYM Antibody - middle region (ARP84298_P050)
Protein Size (# AA) 479 amino acids
Molecular Weight 54 kDa
NCBI Gene Id 54808
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name dymeclin
Alias Symbols DMC, SMC
Peptide Sequence Synthetic peptide located within the following region: GSLLILVVIRTIQYNMTRTRDKYLHTNCLAALANMSAQFRSLHQYAAQRI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a protein which is necessary for normal skeletal development and brain function. Mutations in this gene are associated with two types of recessive osteochondrodysplasia, Dyggve-Melchior-Clausen (DMC) dysplasia and Smith-McCort (SMC) dysplasia, which involve both skeletal defects and mental retardation.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DYM (ARP84298_P050) antibody
Blocking Peptide For anti-DYM (ARP84298_P050) antibody is Catalog # AAP84298
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DYM
Uniprot ID Q7RTS9-2
Protein Name dymeclin
Protein Accession # NP_060123.3
Purification Affinity purified
Nucleotide Accession # NM_017653.3
Tested Species Reactivity Human
Gene Symbol DYM
Predicted Species Reactivity Human
Application WB
Image 1
Human Jurkat Whole Cell
Host: Rabbit
Target Name: DYM
Sample Tissue: Human Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com