Product Number |
ARP84298_P050 |
Product Page |
www.avivasysbio.com/dym-antibody-middle-region-arp84298-p050.html |
Name |
DYM Antibody - middle region (ARP84298_P050) |
Protein Size (# AA) |
479 amino acids |
Molecular Weight |
54 kDa |
NCBI Gene Id |
54808 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
dymeclin |
Alias Symbols |
DMC, SMC |
Peptide Sequence |
Synthetic peptide located within the following region: GSLLILVVIRTIQYNMTRTRDKYLHTNCLAALANMSAQFRSLHQYAAQRI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a protein which is necessary for normal skeletal development and brain function. Mutations in this gene are associated with two types of recessive osteochondrodysplasia, Dyggve-Melchior-Clausen (DMC) dysplasia and Smith-McCort (SMC) dysplasia, which involve both skeletal defects and mental retardation. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DYM (ARP84298_P050) antibody |
Blocking Peptide |
For anti-DYM (ARP84298_P050) antibody is Catalog # AAP84298 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DYM |
Uniprot ID |
Q7RTS9-2 |
Protein Name |
dymeclin |
Protein Accession # |
NP_060123.3 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_017653.3 |
Tested Species Reactivity |
Human |
Gene Symbol |
DYM |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human Jurkat Whole Cell
| Host: Rabbit Target Name: DYM Sample Tissue: Human Jurkat Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|